PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID GSMUA_Achr8P10550_001
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; Liliopsida; Petrosaviidae; commelinids; Zingiberales; Musaceae; Musa
Family TALE
Protein Properties Length: 307aa    MW: 33851 Da    PI: 4.865
Description TALE family protein
Gene Model
Gene Model ID Type Source Coding Sequence
GSMUA_Achr8P10550_001genomeCIRADView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1Homeobox31.43.3e-102422742355
                            SS--HHHHHHHHHHCTS-HHHHHHHHHHHHHHH CS
               Homeobox  23 rypsaeereeLAkklgLterqVkvWFqNrRake 55 
                            +yp++ee+++LA+k+gL+++q+ +WF N+R ++
  GSMUA_Achr8P10550_001 242 PYPTEEEKAKLAEKTGLNQKQINNWFINQRKRH 274
                            8*****************************885 PP

2ELK322.7e-11194215122
                    ELK   1 ELKhqLlrKYsgyLgsLkqEFs 22 
                            ELK++Ll KYsgyL++L++EF+
  GSMUA_Achr8P10550_001 194 ELKQMLLTKYSGYLSNLRKEFL 215
                            9********************8 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
SMARTSM012551.7E-204791IPR005540KNOX1
PfamPF037901.2E-204989IPR005540KNOX1
SMARTSM012561.5E-2594145IPR005541KNOX2
PfamPF037915.4E-2497144IPR005541KNOX2
PROSITE profilePS5121310.72194214IPR005539ELK domain
PfamPF037897.0E-9194215IPR005539ELK domain
SMARTSM011882.5E-6194215IPR005539ELK domain
PROSITE profilePS5007113.167214277IPR001356Homeobox domain
SuperFamilySSF466891.45E-19216283IPR009057Homeodomain-like
SMARTSM003893.9E-14216281IPR001356Homeobox domain
Gene3DG3DSA:1.10.10.603.8E-27219279IPR009057Homeodomain-like
CDDcd000861.35E-13226278No hitNo description
PfamPF059207.1E-18234273IPR008422Homeobox KN domain
PROSITE patternPS000270252275IPR017970Homeobox, conserved site
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006355Biological Processregulation of transcription, DNA-templated
GO:0010073Biological Processmeristem maintenance
GO:0005634Cellular Componentnucleus
GO:0043565Molecular Functionsequence-specific DNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 307 aa     Download sequence    Send to blast
MEDLYSIHPG ILRGGDTPAV GSASSCQGSS DASEVTGSSG GVSDLTDLIK AQIANHPRYP  60
TLLSAYIECR KVGAPPEVAT LLEEIGKESY SSVGGGEIGA DPELDEFMES YCHVLVRYKE  120
ELLKPFDEAA SFLNHIEMQL TDLCKGPSTA PTASAATGNS PSEEVIGSSD EELSCGDLET  180
LEGQECGSRM ADHELKQMLL TKYSGYLSNL RKEFLKKRKK GKLPKDARLT LLDWWNSHCR  240
WPYPTEEEKA KLAEKTGLNQ KQINNWFINQ RKRHWKPSED MRFALMEEVS GGSSRTMLYF  300
DSGTIGP
Nucleic Localization Signal ? help Back to Top
NLS
No. Start End Sequence
1209218LRKEFLKKRK
2215219KKRKK
Binding Motif ? help Back to Top
Motif ID Method Source Motif file
MP00670PBMTransfer from GRMZM2G087741Download
Motif logo
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieveRetrieve
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_009411630.10.0PREDICTED: homeobox protein knotted-1-like 1
RefseqXP_009411631.10.0PREDICTED: homeobox protein knotted-1-like 1
SwissprotQ9FP291e-129KNOS1_ORYSJ; Homeobox protein knotted-1-like 1
TrEMBLM0TPA80.0M0TPA8_MUSAM; Uncharacterized protein
STRINGGSMUA_Achr8P10550_0010.0(Musa acuminata)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
MonocotsOGMP16983892
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT1G23380.14e-77KNOTTED1-like homeobox gene 6